Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

7,291 – 7,305 of 119,628 results

7,291

R&D Systems™ Recombinant Human TMIGD2/CD28H Fc Avi-tag Protein

Biotinylated Fc Chimera

Pricing & Availability

7,292

R&D Systems™ Recombinant Human Fibulin 1C Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,293

MilliporeSigma™ γ-Interferon, Human, Recombinant Protein, E. coli

Pricing & Availability

7,294

Novus Biologicals™ MGP Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

7,295

MilliporeSigma™ HumanKine™ Human IL-2 Recombinant Protein, Xeno-Free

Pricing & Availability

7,296

Promotions Available

R&D Systems™ Recombinant Mouse IFN-beta Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,297

R&D Systems™ Recombinant Human Active PYK2/FAK2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

7,298

R&D Systems™ Recombinant SARS-CoV Spike RBD His-tag Protein

HEK293 Expressed

Pricing & Availability

7,299

Invitrogen™ Mouse LILRB4 (CD85k, ILT3) His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Purity or Quality Grade	>95% as determined by SDS-PAGE.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	LILRB4 (CD85k)
Molecular Weight (g/mol)	39.8 kDa
Gene Symbol	Lilrb4a
Endotoxin Concentration	<1.0 EU/μg
Sequence	Mouse LILRB4, amino acids Met1-Lys238 (Accession # NP_038560.1) with a C-terminal His-tag
Expression System	HEK293 cells
For Use With (Application)	Control,Neutralization
Name	Mouse LILRB4 (CD85k, ILT3) His-tag
Accession Number	Q64281
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	CD85 antigen-like family member K; CD85K; glycoprotein 49 B; glycoprotein 49b; gp49; Gp49b; GP49B2; HM18; ILT3; ILT-3; Immunoglobulin-like transcript 3; leucocyte Ig-like receptor B4; leukocyte immunoglobulin like receptor B4; leukocyte immunoglobulin-like receptor 5; Leukocyte immunoglobulin-like receptor subfamily B member 4; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4; leukocyte immunoglobulin-like receptor, subfamily B, member 4; leukocyte surface receptor; Lilrb4; LIR5; LIR-5; mast cell surface glycoprotein Gp49B; Monocyte inhibitory receptor HM18
Format	Lyophilized
Product Type	Protein
Gene ID (Entrez)	14728
Formulation	PBS with 5% mannitol, 5% trehalose, 0.01% Tween 80 and no preservative; pH 7.4
Protein Tag	His-tag
Recombinant	Recombinant

7,300

Novus Biologicals™ Recombinant Human TBCA Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,301

Novus Biologicals™ PGAM1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PGAM1
Molecular Weight (g/mol)	30.9kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT.
Immunogen	PGAM1, 1-254 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

7,302

Promotions Available

R&D Systems™ Recombinant Human S100A7 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,303

R&D Systems™ Recombinant Human ACP6 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,304

Promotions Available

R&D Systems™ Recombinant Mouse TRAIL R2/TNFRSF10B Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,305

R&D Systems™ Recombinant Mouse Ephrin-B1 Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

Prev
1
...
485
486
487
488
...
7,976
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ MGP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TBCA Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PGAM1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ MGP Protein

Novus Biologicals™ Recombinant Human TBCA Protein

Novus Biologicals™ PGAM1 Protein